Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XFQ9

Protein Details
Accession A0A0C9XFQ9    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-99GRYSRYCRYSRCCRYSRCRRSFRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8plas 8, nucl 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MILAAVMPLGMWTEVLDLTIAPFIRIRRFNYGYYRSVQLPLVGHINKYNGREWWERVITDSRRVFRVFRYARSFRYGRYSRYCRYSRCCRYSRCRRSFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.05
5 0.06
6 0.08
7 0.08
8 0.07
9 0.1
10 0.12
11 0.18
12 0.23
13 0.26
14 0.32
15 0.35
16 0.39
17 0.45
18 0.49
19 0.45
20 0.43
21 0.42
22 0.34
23 0.33
24 0.29
25 0.22
26 0.17
27 0.16
28 0.19
29 0.16
30 0.16
31 0.15
32 0.18
33 0.19
34 0.2
35 0.2
36 0.16
37 0.21
38 0.23
39 0.24
40 0.27
41 0.25
42 0.23
43 0.25
44 0.31
45 0.28
46 0.34
47 0.36
48 0.32
49 0.33
50 0.35
51 0.33
52 0.28
53 0.37
54 0.32
55 0.35
56 0.42
57 0.43
58 0.45
59 0.5
60 0.49
61 0.4
62 0.48
63 0.45
64 0.43
65 0.49
66 0.54
67 0.52
68 0.61
69 0.64
70 0.61
71 0.66
72 0.7
73 0.71
74 0.73
75 0.76
76 0.76
77 0.81
78 0.85
79 0.88