Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZV56

Protein Details
Accession A0A0C9ZV56   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-24KRIGNELRRRANKPNRQITDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 10.833, cyto_nucl 8.833, mito 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQMTKRIGNELRRRANKPNRQITDIDSIRIDHLARCAELPVGHNEPFWYILARRFLLNDFSRLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.8
4 0.8
5 0.8
6 0.74
7 0.71
8 0.67
9 0.61
10 0.59
11 0.5
12 0.41
13 0.31
14 0.26
15 0.23
16 0.22
17 0.18
18 0.09
19 0.1
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.1
26 0.11
27 0.14
28 0.17
29 0.17
30 0.17
31 0.17
32 0.17
33 0.18
34 0.17
35 0.14
36 0.12
37 0.17
38 0.21
39 0.22
40 0.22
41 0.22
42 0.23
43 0.29
44 0.3