Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YZ88

Protein Details
Accession A0A0C9YZ88    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAKSKNHTNHNQNRKAHRNGIKRPKTNRSRSMKHydrophilic
NLS Segment(s)
PositionSequence
14-53RKAHRNGIKRPKTNRSRSMKGVDPKFRKNALHALVGSRKA
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKRPKTNRSRSMKGVDPKFRKNALHALVGSRKARAEQKLAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.78
5 0.77
6 0.78
7 0.82
8 0.82
9 0.81
10 0.82
11 0.83
12 0.83
13 0.82
14 0.81
15 0.79
16 0.74
17 0.71
18 0.68
19 0.65
20 0.62
21 0.62
22 0.61
23 0.59
24 0.59
25 0.59
26 0.58
27 0.52
28 0.48
29 0.48
30 0.42
31 0.41
32 0.36
33 0.36
34 0.37
35 0.42
36 0.39
37 0.32
38 0.3
39 0.3
40 0.36
41 0.35
42 0.36