Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Y1Y3

Protein Details
Accession A0A0C9Y1Y3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-50ASQSQVSKSKSKKKKKLPKPRTPSHNEFKKSHydrophilic
NLS Segment(s)
PositionSequence
27-42KSKSKKKKKLPKPRTP
Subcellular Location(s) nucl 19.5, cyto_nucl 14, mito 4
Family & Domain DBs
Amino Acid Sequences MYQKALLNLLNQSTRSSSRASQSQVSKSKSKKKKKLPKPRTPSHNEFKKSVQELGQELLGLEDYKDLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.24
5 0.26
6 0.31
7 0.32
8 0.35
9 0.38
10 0.44
11 0.48
12 0.5
13 0.52
14 0.54
15 0.61
16 0.65
17 0.71
18 0.72
19 0.76
20 0.83
21 0.87
22 0.91
23 0.92
24 0.92
25 0.91
26 0.91
27 0.89
28 0.87
29 0.84
30 0.83
31 0.81
32 0.73
33 0.67
34 0.61
35 0.6
36 0.54
37 0.49
38 0.41
39 0.35
40 0.33
41 0.32
42 0.29
43 0.2
44 0.17
45 0.15
46 0.13
47 0.1
48 0.08