Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YD26

Protein Details
Accession A0A0C9YD26    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-66NFFFCKWKGNIKFCPRPQTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 5, extr 4, pero 2
Family & Domain DBs
Amino Acid Sequences MGSVNPISPPFLSNTEVKHGILPLMLLVCLSKMPHRENLMFDALKPNFFFCKWKGNIKFCPRPQTTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.27
4 0.26
5 0.24
6 0.21
7 0.19
8 0.16
9 0.13
10 0.08
11 0.07
12 0.06
13 0.05
14 0.04
15 0.04
16 0.04
17 0.05
18 0.07
19 0.11
20 0.13
21 0.17
22 0.21
23 0.22
24 0.24
25 0.27
26 0.29
27 0.25
28 0.23
29 0.27
30 0.24
31 0.24
32 0.23
33 0.21
34 0.19
35 0.2
36 0.24
37 0.18
38 0.28
39 0.3
40 0.41
41 0.48
42 0.54
43 0.63
44 0.69
45 0.77
46 0.74
47 0.81