Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XYK2

Protein Details
Accession A0A0C9XYK2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-86CNSVKSFVEKRKKQEHAKDQLHAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 10.333, mito 7, cyto_mito 6.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
Amino Acid Sequences MTISLQPGVGKSTLINRTFGIERASAENSEPGKASIEKELISQQNDRFVLHDSAGFEPADNVDCNSVKSFVEKRKKQEHAKDQLHAVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.25
4 0.29
5 0.29
6 0.3
7 0.25
8 0.18
9 0.18
10 0.2
11 0.21
12 0.18
13 0.17
14 0.2
15 0.18
16 0.18
17 0.17
18 0.14
19 0.15
20 0.15
21 0.16
22 0.14
23 0.14
24 0.13
25 0.14
26 0.18
27 0.18
28 0.19
29 0.21
30 0.18
31 0.22
32 0.22
33 0.21
34 0.18
35 0.19
36 0.18
37 0.16
38 0.17
39 0.13
40 0.14
41 0.15
42 0.14
43 0.11
44 0.1
45 0.1
46 0.1
47 0.09
48 0.08
49 0.1
50 0.1
51 0.12
52 0.13
53 0.14
54 0.12
55 0.17
56 0.24
57 0.31
58 0.42
59 0.47
60 0.54
61 0.63
62 0.72
63 0.78
64 0.82
65 0.83
66 0.83
67 0.83
68 0.79