Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZZ18

Protein Details
Accession A0A0C9ZZ18    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-28FLPGRRVPTRHCKRKNYPRRRSLSAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVFLPGRRVPTRHCKRKNYPRRRSLSAAGSPHVSAYTTSCYVYAAVAVEWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.88
4 0.92
5 0.92
6 0.92
7 0.91
8 0.88
9 0.84
10 0.78
11 0.72
12 0.68
13 0.62
14 0.54
15 0.44
16 0.38
17 0.32
18 0.27
19 0.22
20 0.15
21 0.1
22 0.1
23 0.13
24 0.13
25 0.13
26 0.13
27 0.13
28 0.13
29 0.13
30 0.12
31 0.08