Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A3C3

Protein Details
Accession A0A0D0A3C3   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
286-311EESDTEVRRKRPPRTAPKSSSQRSLIHydrophilic
NLS Segment(s)
PositionSequence
146-165TPRKPAAPARVRRVSTPKPK
293-304RRKRPPRTAPKS
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MVTFTGVTKRRLVQSSDVTVPSGGRTQLSVSTSNSQQPDFGKKTWSSFSANEIDLTTPSLCSDNERDGDGSLEDQTPSTPPGPQPAVTERRAGLREPDIIDVDLELEDVDCDTNSRGISPSPRSSRSRKSDIFEKRPPMSPIPDSTPRKPAAPARVRRVSTPKPKHIPPPSDSDSDTNRRNIDAVPFISLIPSSRDKPTSHRKRSSVNRNQVAKPGRFKDDRRPATLDEELRTAQPQATDVGGAESIEDDVFAATGTKNSRKGFLAHGGGGGPPVFMGVGYVQGAEESDTEVRRKRPPRTAPKSSSQRSLIPRLGGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.53
4 0.49
5 0.43
6 0.39
7 0.35
8 0.29
9 0.24
10 0.18
11 0.14
12 0.14
13 0.15
14 0.19
15 0.21
16 0.22
17 0.22
18 0.26
19 0.29
20 0.34
21 0.34
22 0.3
23 0.3
24 0.31
25 0.37
26 0.36
27 0.35
28 0.36
29 0.36
30 0.4
31 0.41
32 0.41
33 0.37
34 0.33
35 0.37
36 0.35
37 0.34
38 0.3
39 0.27
40 0.24
41 0.2
42 0.21
43 0.16
44 0.11
45 0.11
46 0.12
47 0.11
48 0.14
49 0.18
50 0.2
51 0.21
52 0.23
53 0.22
54 0.21
55 0.22
56 0.18
57 0.16
58 0.13
59 0.12
60 0.11
61 0.1
62 0.1
63 0.1
64 0.12
65 0.12
66 0.13
67 0.12
68 0.19
69 0.21
70 0.22
71 0.24
72 0.3
73 0.35
74 0.34
75 0.36
76 0.31
77 0.34
78 0.34
79 0.31
80 0.27
81 0.24
82 0.26
83 0.25
84 0.26
85 0.22
86 0.21
87 0.2
88 0.15
89 0.13
90 0.09
91 0.07
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.04
99 0.05
100 0.06
101 0.06
102 0.07
103 0.08
104 0.09
105 0.15
106 0.2
107 0.27
108 0.3
109 0.36
110 0.4
111 0.46
112 0.54
113 0.56
114 0.59
115 0.56
116 0.55
117 0.6
118 0.65
119 0.67
120 0.64
121 0.62
122 0.56
123 0.57
124 0.55
125 0.49
126 0.43
127 0.36
128 0.33
129 0.32
130 0.39
131 0.4
132 0.39
133 0.42
134 0.39
135 0.38
136 0.38
137 0.37
138 0.38
139 0.42
140 0.46
141 0.48
142 0.54
143 0.53
144 0.54
145 0.57
146 0.55
147 0.57
148 0.59
149 0.6
150 0.58
151 0.6
152 0.66
153 0.66
154 0.63
155 0.55
156 0.55
157 0.5
158 0.47
159 0.45
160 0.39
161 0.36
162 0.36
163 0.36
164 0.3
165 0.27
166 0.25
167 0.24
168 0.22
169 0.2
170 0.18
171 0.16
172 0.15
173 0.15
174 0.15
175 0.14
176 0.13
177 0.11
178 0.11
179 0.13
180 0.14
181 0.16
182 0.19
183 0.2
184 0.28
185 0.39
186 0.46
187 0.53
188 0.59
189 0.6
190 0.67
191 0.76
192 0.8
193 0.79
194 0.78
195 0.77
196 0.75
197 0.73
198 0.71
199 0.68
200 0.61
201 0.58
202 0.52
203 0.5
204 0.5
205 0.52
206 0.56
207 0.6
208 0.6
209 0.57
210 0.57
211 0.53
212 0.53
213 0.55
214 0.46
215 0.37
216 0.34
217 0.3
218 0.26
219 0.25
220 0.2
221 0.15
222 0.13
223 0.12
224 0.11
225 0.1
226 0.1
227 0.09
228 0.09
229 0.08
230 0.08
231 0.07
232 0.06
233 0.06
234 0.05
235 0.05
236 0.04
237 0.04
238 0.04
239 0.04
240 0.05
241 0.04
242 0.08
243 0.12
244 0.17
245 0.23
246 0.24
247 0.28
248 0.29
249 0.31
250 0.34
251 0.37
252 0.37
253 0.31
254 0.31
255 0.28
256 0.26
257 0.25
258 0.19
259 0.11
260 0.07
261 0.06
262 0.05
263 0.04
264 0.05
265 0.05
266 0.06
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.07
274 0.08
275 0.11
276 0.13
277 0.17
278 0.23
279 0.27
280 0.36
281 0.45
282 0.51
283 0.59
284 0.68
285 0.76
286 0.8
287 0.86
288 0.84
289 0.86
290 0.88
291 0.83
292 0.8
293 0.73
294 0.71
295 0.67
296 0.69
297 0.63
298 0.59