Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XWJ8

Protein Details
Accession A0A0C9XWJ8   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-31SSCVEREKRSVKRSRSGRNKVCEIRFHydrophilic
NLS Segment(s)
PositionSequence
13-25KRSVKRSRSGRNK
30-46RFHTRKSSPSGKRRFKG
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MATTASSCVEREKRSVKRSRSGRNKVCEIRFHTRKSSPSGKRRFKGQAASGGRPDTAPSNVQDITFLEYEQRSIEGGIVQGPLDRSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.65
4 0.69
5 0.76
6 0.8
7 0.82
8 0.84
9 0.83
10 0.81
11 0.83
12 0.81
13 0.76
14 0.72
15 0.68
16 0.67
17 0.65
18 0.62
19 0.59
20 0.55
21 0.54
22 0.54
23 0.56
24 0.55
25 0.59
26 0.66
27 0.68
28 0.65
29 0.69
30 0.68
31 0.62
32 0.59
33 0.52
34 0.51
35 0.48
36 0.48
37 0.44
38 0.38
39 0.34
40 0.28
41 0.25
42 0.18
43 0.14
44 0.13
45 0.13
46 0.16
47 0.16
48 0.16
49 0.16
50 0.15
51 0.16
52 0.15
53 0.14
54 0.13
55 0.12
56 0.13
57 0.13
58 0.13
59 0.09
60 0.09
61 0.1
62 0.08
63 0.09
64 0.1
65 0.1
66 0.09
67 0.1