Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZPI2

Protein Details
Accession A0A0C9ZPI2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-87DGFDVDRRSRRPRPESRRPVPPSPABasic
339-371EPILKKAKLLRRDPRMVERKKTGLAKARKRYTWHydrophilic
NLS Segment(s)
PositionSequence
71-79SRRPRPESR
343-374KKAKLLRRDPRMVERKKTGLAKARKRYTWVKR
Subcellular Location(s) mito 19, cyto 5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR000754  Ribosomal_S9  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00380  Ribosomal_S9  
Amino Acid Sequences MATVGLKAFELFASRLSCRPPRLHVLALRSLTTTAATTPPPPNSRFVPPASLETMDEAQLEGDGFDVDRRSRRPRPESRRPVPPSPAFYTARSLYYDTLVQLQSALSLSRRALRAQHLLPLPPFALRALPPAQPAWANKAEMSLILQAPLTARMYKRVVMLLRELDQYERIARVADATELEDAITDITKGFESKKGIQARDTRIRAREVKERGPLDRYGRSYTVGRRKTSAARVWMIEVQKPKDSTSEPVANTTSILSSSNATTPPPPTSTVLINSVPISNYFPLPADREGVLRPLKLAGLLGAFNVFALVRGGGTSGQSGAIALAVAKGCVAHVPEVEPILKKAKLLRRDPRMVERKKTGLAKARKRYTWVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.29
4 0.35
5 0.38
6 0.42
7 0.45
8 0.5
9 0.54
10 0.58
11 0.57
12 0.58
13 0.59
14 0.56
15 0.5
16 0.42
17 0.37
18 0.3
19 0.25
20 0.19
21 0.13
22 0.14
23 0.14
24 0.18
25 0.23
26 0.3
27 0.35
28 0.36
29 0.39
30 0.4
31 0.46
32 0.46
33 0.44
34 0.43
35 0.39
36 0.41
37 0.4
38 0.37
39 0.3
40 0.28
41 0.27
42 0.21
43 0.19
44 0.15
45 0.11
46 0.1
47 0.1
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.09
54 0.11
55 0.16
56 0.22
57 0.3
58 0.38
59 0.48
60 0.57
61 0.66
62 0.74
63 0.8
64 0.86
65 0.85
66 0.88
67 0.85
68 0.82
69 0.8
70 0.76
71 0.71
72 0.65
73 0.64
74 0.56
75 0.5
76 0.48
77 0.41
78 0.36
79 0.31
80 0.28
81 0.22
82 0.21
83 0.21
84 0.16
85 0.18
86 0.16
87 0.14
88 0.13
89 0.12
90 0.1
91 0.1
92 0.1
93 0.07
94 0.09
95 0.09
96 0.14
97 0.15
98 0.16
99 0.19
100 0.24
101 0.3
102 0.29
103 0.35
104 0.32
105 0.33
106 0.32
107 0.3
108 0.25
109 0.19
110 0.18
111 0.12
112 0.12
113 0.1
114 0.14
115 0.15
116 0.16
117 0.17
118 0.17
119 0.17
120 0.18
121 0.19
122 0.21
123 0.2
124 0.2
125 0.18
126 0.19
127 0.18
128 0.15
129 0.16
130 0.12
131 0.09
132 0.09
133 0.09
134 0.08
135 0.08
136 0.1
137 0.1
138 0.09
139 0.1
140 0.14
141 0.16
142 0.17
143 0.18
144 0.2
145 0.2
146 0.2
147 0.22
148 0.19
149 0.2
150 0.19
151 0.18
152 0.15
153 0.15
154 0.14
155 0.12
156 0.11
157 0.09
158 0.08
159 0.08
160 0.08
161 0.08
162 0.07
163 0.07
164 0.07
165 0.07
166 0.06
167 0.06
168 0.05
169 0.05
170 0.04
171 0.04
172 0.03
173 0.03
174 0.04
175 0.04
176 0.04
177 0.06
178 0.09
179 0.13
180 0.16
181 0.23
182 0.28
183 0.29
184 0.34
185 0.39
186 0.44
187 0.49
188 0.5
189 0.46
190 0.43
191 0.47
192 0.47
193 0.44
194 0.45
195 0.41
196 0.43
197 0.46
198 0.46
199 0.43
200 0.41
201 0.41
202 0.37
203 0.37
204 0.35
205 0.31
206 0.3
207 0.3
208 0.3
209 0.35
210 0.4
211 0.41
212 0.39
213 0.38
214 0.4
215 0.44
216 0.48
217 0.45
218 0.4
219 0.37
220 0.36
221 0.36
222 0.37
223 0.32
224 0.29
225 0.28
226 0.26
227 0.27
228 0.28
229 0.26
230 0.25
231 0.26
232 0.26
233 0.27
234 0.31
235 0.28
236 0.3
237 0.3
238 0.27
239 0.25
240 0.22
241 0.16
242 0.09
243 0.1
244 0.08
245 0.08
246 0.09
247 0.11
248 0.11
249 0.12
250 0.13
251 0.14
252 0.16
253 0.17
254 0.19
255 0.19
256 0.21
257 0.22
258 0.23
259 0.24
260 0.22
261 0.21
262 0.2
263 0.18
264 0.16
265 0.15
266 0.16
267 0.13
268 0.13
269 0.12
270 0.13
271 0.14
272 0.17
273 0.17
274 0.16
275 0.16
276 0.17
277 0.17
278 0.22
279 0.23
280 0.2
281 0.19
282 0.18
283 0.17
284 0.16
285 0.15
286 0.1
287 0.09
288 0.09
289 0.08
290 0.08
291 0.07
292 0.07
293 0.07
294 0.06
295 0.05
296 0.05
297 0.05
298 0.05
299 0.05
300 0.06
301 0.06
302 0.07
303 0.07
304 0.07
305 0.07
306 0.07
307 0.07
308 0.06
309 0.06
310 0.05
311 0.04
312 0.06
313 0.06
314 0.06
315 0.06
316 0.06
317 0.06
318 0.08
319 0.1
320 0.1
321 0.11
322 0.13
323 0.14
324 0.17
325 0.19
326 0.19
327 0.2
328 0.23
329 0.23
330 0.23
331 0.31
332 0.37
333 0.44
334 0.53
335 0.61
336 0.65
337 0.74
338 0.78
339 0.8
340 0.83
341 0.82
342 0.8
343 0.78
344 0.74
345 0.73
346 0.73
347 0.7
348 0.7
349 0.72
350 0.74
351 0.77
352 0.8
353 0.77
354 0.77