Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BWG7

Protein Details
Accession Q6BWG7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
279-310VETTTKVETKKKDTKKKVVRKKEVRKVAVGKGBasic
NLS Segment(s)
PositionSequence
288-309KKKDTKKKVVRKKEVRKVAVGK
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040456  RNase_H2_suB  
IPR019024  RNase_H2_suB_wHTH  
IPR041195  Rnh202_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0032299  C:ribonuclease H2 complex  
KEGG dha:DEHA2B11484g  -  
Pfam View protein in Pfam  
PF09468  RNase_H2-Ydr279  
PF17745  Ydr279_N  
CDD cd09270  RNase_H2-B  
Amino Acid Sequences MNIHEGTKVILLPKEKGLYSIIKLPNVLDQKSFKSYLLRDDQLFELREIKGDNRYLSNDNKRPVIPNTGSSVKSFIFESEANGCVVQSPNLIVSTKFNLVYYLMSIMYNNDSFAKRFITFEDFSDTISSLFEYNAWVGAVPMTMYKSALSEICETIEENDEIFYKYSNAKVIEYLHRKVSQLSAYLSSQSDLSIISKIKQELYRPISEGSNDIPSDILQLSIIRHSIDLICGSYTPIEIRNQVMNNERYEFDKLNAYLKDISAQRKELELVESNMNAVVETTTKVETKKKDTKKKVVRKKEVRKVAVGKGALDGFFKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.29
4 0.29
5 0.3
6 0.3
7 0.36
8 0.35
9 0.33
10 0.33
11 0.32
12 0.37
13 0.37
14 0.36
15 0.31
16 0.31
17 0.34
18 0.39
19 0.4
20 0.33
21 0.35
22 0.35
23 0.39
24 0.44
25 0.42
26 0.38
27 0.4
28 0.41
29 0.39
30 0.39
31 0.31
32 0.27
33 0.23
34 0.24
35 0.23
36 0.22
37 0.23
38 0.25
39 0.27
40 0.26
41 0.3
42 0.33
43 0.4
44 0.48
45 0.48
46 0.48
47 0.5
48 0.48
49 0.48
50 0.47
51 0.47
52 0.39
53 0.36
54 0.39
55 0.39
56 0.39
57 0.35
58 0.34
59 0.25
60 0.24
61 0.21
62 0.16
63 0.15
64 0.14
65 0.16
66 0.16
67 0.16
68 0.16
69 0.15
70 0.14
71 0.12
72 0.13
73 0.11
74 0.08
75 0.08
76 0.09
77 0.1
78 0.11
79 0.09
80 0.11
81 0.14
82 0.16
83 0.16
84 0.15
85 0.14
86 0.15
87 0.15
88 0.13
89 0.11
90 0.09
91 0.08
92 0.08
93 0.09
94 0.1
95 0.1
96 0.1
97 0.11
98 0.11
99 0.12
100 0.13
101 0.15
102 0.14
103 0.14
104 0.16
105 0.19
106 0.19
107 0.2
108 0.24
109 0.21
110 0.21
111 0.21
112 0.19
113 0.13
114 0.12
115 0.12
116 0.06
117 0.06
118 0.06
119 0.06
120 0.05
121 0.06
122 0.05
123 0.05
124 0.04
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.07
136 0.08
137 0.09
138 0.09
139 0.1
140 0.1
141 0.09
142 0.1
143 0.11
144 0.09
145 0.07
146 0.07
147 0.07
148 0.08
149 0.08
150 0.07
151 0.07
152 0.08
153 0.09
154 0.12
155 0.12
156 0.12
157 0.13
158 0.16
159 0.23
160 0.27
161 0.28
162 0.28
163 0.29
164 0.29
165 0.28
166 0.28
167 0.22
168 0.19
169 0.19
170 0.17
171 0.16
172 0.17
173 0.17
174 0.14
175 0.12
176 0.1
177 0.09
178 0.06
179 0.07
180 0.08
181 0.09
182 0.1
183 0.12
184 0.13
185 0.17
186 0.19
187 0.21
188 0.27
189 0.32
190 0.32
191 0.31
192 0.32
193 0.29
194 0.27
195 0.26
196 0.19
197 0.18
198 0.16
199 0.14
200 0.13
201 0.12
202 0.14
203 0.12
204 0.1
205 0.06
206 0.07
207 0.08
208 0.09
209 0.09
210 0.08
211 0.08
212 0.08
213 0.08
214 0.09
215 0.09
216 0.09
217 0.09
218 0.08
219 0.09
220 0.08
221 0.08
222 0.08
223 0.1
224 0.12
225 0.13
226 0.15
227 0.2
228 0.21
229 0.24
230 0.3
231 0.31
232 0.31
233 0.32
234 0.3
235 0.28
236 0.31
237 0.29
238 0.23
239 0.27
240 0.25
241 0.29
242 0.28
243 0.29
244 0.25
245 0.24
246 0.28
247 0.26
248 0.32
249 0.31
250 0.33
251 0.31
252 0.31
253 0.32
254 0.28
255 0.28
256 0.25
257 0.24
258 0.24
259 0.23
260 0.21
261 0.21
262 0.19
263 0.14
264 0.11
265 0.09
266 0.07
267 0.08
268 0.1
269 0.11
270 0.13
271 0.16
272 0.23
273 0.29
274 0.38
275 0.48
276 0.57
277 0.66
278 0.75
279 0.83
280 0.87
281 0.92
282 0.93
283 0.94
284 0.95
285 0.95
286 0.96
287 0.95
288 0.95
289 0.89
290 0.87
291 0.83
292 0.79
293 0.76
294 0.66
295 0.56
296 0.49
297 0.45
298 0.36
299 0.31