Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZLG3

Protein Details
Accession A0A0C9ZLG3    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-53MPRIRKKTSKRIPTHQRQKIKHKVAANRKKVKKQSKKDKATGKIQKKSKRDPGBasic
136-157AVPNPSNHRRERAKRTRTPISGHydrophilic
NLS Segment(s)
PositionSequence
3-51RIRKKTSKRIPTHQRQKIKHKVAANRKKVKKQSKKDKATGKIQKKSKRD
78-91EKQRRKAEKRAAKV
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MPRIRKKTSKRIPTHQRQKIKHKVAANRKKVKKQSKKDKATGKIQKKSKRDPGIPNAFPYKEEILAEIEQQRREAAIEKQRRKAEKRAAKVGAREADETRSQVSEKAGEGEEIIETEKNDGCGFDGVMSIEKQPIAVPNPSNHRRERAKRTRTPISG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.91
4 0.89
5 0.9
6 0.9
7 0.88
8 0.83
9 0.8
10 0.8
11 0.81
12 0.83
13 0.83
14 0.83
15 0.82
16 0.86
17 0.88
18 0.89
19 0.89
20 0.89
21 0.9
22 0.9
23 0.91
24 0.9
25 0.89
26 0.85
27 0.85
28 0.85
29 0.83
30 0.81
31 0.8
32 0.8
33 0.79
34 0.81
35 0.8
36 0.78
37 0.76
38 0.76
39 0.77
40 0.78
41 0.72
42 0.65
43 0.6
44 0.51
45 0.43
46 0.38
47 0.29
48 0.2
49 0.19
50 0.16
51 0.15
52 0.15
53 0.16
54 0.17
55 0.18
56 0.17
57 0.18
58 0.17
59 0.14
60 0.14
61 0.15
62 0.16
63 0.23
64 0.32
65 0.37
66 0.44
67 0.49
68 0.54
69 0.56
70 0.59
71 0.6
72 0.59
73 0.6
74 0.62
75 0.62
76 0.6
77 0.57
78 0.54
79 0.47
80 0.4
81 0.36
82 0.29
83 0.26
84 0.25
85 0.23
86 0.19
87 0.16
88 0.14
89 0.14
90 0.14
91 0.13
92 0.12
93 0.14
94 0.13
95 0.12
96 0.12
97 0.11
98 0.09
99 0.08
100 0.09
101 0.07
102 0.07
103 0.08
104 0.09
105 0.1
106 0.1
107 0.09
108 0.1
109 0.1
110 0.1
111 0.09
112 0.09
113 0.08
114 0.1
115 0.11
116 0.1
117 0.1
118 0.1
119 0.1
120 0.1
121 0.14
122 0.16
123 0.2
124 0.22
125 0.28
126 0.38
127 0.44
128 0.49
129 0.49
130 0.55
131 0.6
132 0.67
133 0.72
134 0.74
135 0.78
136 0.81
137 0.86