Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZHN2

Protein Details
Accession A0A0C9ZHN2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSSKRGRKRNDNLPPNRARDVHydrophilic
NLS Segment(s)
PositionSequence
7-8RK
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSSKRGRKRNDNLPPNRARDVQRAFRARRAAHLQALESRVTELEEENNCLRAALNLPPASRPPLGKGPTGKDKPKSLDSQPGSQSLASKSRDSSPIAESPSPRRSESTSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.81
3 0.76
4 0.7
5 0.63
6 0.62
7 0.61
8 0.6
9 0.61
10 0.64
11 0.63
12 0.64
13 0.66
14 0.57
15 0.57
16 0.55
17 0.5
18 0.45
19 0.44
20 0.39
21 0.35
22 0.36
23 0.29
24 0.22
25 0.18
26 0.14
27 0.13
28 0.12
29 0.08
30 0.11
31 0.11
32 0.14
33 0.14
34 0.15
35 0.15
36 0.14
37 0.14
38 0.1
39 0.11
40 0.1
41 0.14
42 0.15
43 0.15
44 0.16
45 0.17
46 0.2
47 0.19
48 0.17
49 0.16
50 0.22
51 0.24
52 0.27
53 0.29
54 0.32
55 0.4
56 0.46
57 0.48
58 0.45
59 0.48
60 0.49
61 0.51
62 0.51
63 0.45
64 0.49
65 0.47
66 0.49
67 0.46
68 0.43
69 0.39
70 0.35
71 0.33
72 0.27
73 0.3
74 0.26
75 0.26
76 0.26
77 0.29
78 0.32
79 0.32
80 0.31
81 0.29
82 0.31
83 0.35
84 0.37
85 0.36
86 0.41
87 0.45
88 0.46
89 0.43
90 0.42