Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A6Q5

Protein Details
Accession A0A0D0A6Q5   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-38EHIKRHGRRLDYYERKRKKEARAVHKSSAIBasic
45-66LKAKILHAKRHREKVQLKKTLKBasic
NLS Segment(s)
PositionSequence
22-63ERKRKKEARAVHKSSAIAQKTFGLKAKILHAKRHREKVQLKK
108-114QKRKDKA
Subcellular Location(s) nucl 15.5, cyto 10, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11381  NSA2  
Amino Acid Sequences MPQNEYIEEHIKRHGRRLDYYERKRKKEARAVHKSSAIAQKTFGLKAKILHAKRHREKVQLKKTLKVHDERNVKQADSSTVPDGALPAYLLDREGQKDAKALSSAIKQKRKDKAAKYSVPLPKVRGIAEDEMFKVVKTGKNKSKSWKRMVTKATFVGEGFTRKPVKMERFIRPMALRYKKANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTTGGKVVFGKYAQITNNPENDGCVNAVLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.54
4 0.6
5 0.63
6 0.67
7 0.76
8 0.78
9 0.8
10 0.81
11 0.84
12 0.84
13 0.84
14 0.83
15 0.82
16 0.82
17 0.84
18 0.85
19 0.81
20 0.77
21 0.67
22 0.63
23 0.62
24 0.54
25 0.43
26 0.37
27 0.36
28 0.34
29 0.36
30 0.33
31 0.27
32 0.25
33 0.27
34 0.34
35 0.39
36 0.39
37 0.46
38 0.52
39 0.6
40 0.67
41 0.75
42 0.72
43 0.73
44 0.79
45 0.8
46 0.82
47 0.81
48 0.75
49 0.73
50 0.73
51 0.72
52 0.69
53 0.64
54 0.6
55 0.58
56 0.65
57 0.6
58 0.61
59 0.54
60 0.48
61 0.43
62 0.38
63 0.33
64 0.26
65 0.26
66 0.2
67 0.19
68 0.18
69 0.17
70 0.16
71 0.12
72 0.09
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.09
81 0.11
82 0.12
83 0.12
84 0.13
85 0.14
86 0.14
87 0.13
88 0.12
89 0.12
90 0.17
91 0.25
92 0.31
93 0.38
94 0.41
95 0.49
96 0.56
97 0.62
98 0.65
99 0.64
100 0.67
101 0.69
102 0.7
103 0.65
104 0.66
105 0.61
106 0.57
107 0.51
108 0.43
109 0.37
110 0.34
111 0.31
112 0.24
113 0.22
114 0.2
115 0.2
116 0.18
117 0.15
118 0.14
119 0.14
120 0.12
121 0.1
122 0.1
123 0.12
124 0.15
125 0.23
126 0.3
127 0.37
128 0.4
129 0.5
130 0.59
131 0.64
132 0.69
133 0.7
134 0.67
135 0.68
136 0.72
137 0.66
138 0.59
139 0.54
140 0.46
141 0.37
142 0.33
143 0.26
144 0.2
145 0.18
146 0.15
147 0.17
148 0.18
149 0.17
150 0.2
151 0.25
152 0.3
153 0.37
154 0.43
155 0.45
156 0.5
157 0.5
158 0.52
159 0.47
160 0.46
161 0.46
162 0.47
163 0.43
164 0.4
165 0.46
166 0.48
167 0.5
168 0.53
169 0.49
170 0.51
171 0.54
172 0.52
173 0.51
174 0.45
175 0.43
176 0.37
177 0.33
178 0.26
179 0.19
180 0.19
181 0.15
182 0.19
183 0.21
184 0.22
185 0.21
186 0.25
187 0.28
188 0.32
189 0.34
190 0.31
191 0.33
192 0.33
193 0.39
194 0.38
195 0.36
196 0.31
197 0.32
198 0.32
199 0.28
200 0.25
201 0.18
202 0.13
203 0.13
204 0.13
205 0.09
206 0.07
207 0.09
208 0.09
209 0.11
210 0.11
211 0.1
212 0.1
213 0.09
214 0.09
215 0.06
216 0.06
217 0.05
218 0.05
219 0.06
220 0.06
221 0.06
222 0.07
223 0.08
224 0.1
225 0.1
226 0.14
227 0.15
228 0.2
229 0.21
230 0.27
231 0.33
232 0.36
233 0.4
234 0.39
235 0.37
236 0.35
237 0.34
238 0.3
239 0.24
240 0.18