Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZQ53

Protein Details
Accession A0A0C9ZQ53    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-64FLCGTLTLRKCRRCRRQPCLDELKTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 7.5, cyto_mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MESRPEGYLTSVVSHAGSSRLPLLWRLVCTIASEGQHAFLCGTLTLRKCRRCRRQPCLDELKTTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.08
6 0.09
7 0.1
8 0.1
9 0.11
10 0.15
11 0.15
12 0.16
13 0.17
14 0.16
15 0.15
16 0.16
17 0.16
18 0.13
19 0.12
20 0.12
21 0.1
22 0.11
23 0.11
24 0.1
25 0.09
26 0.07
27 0.07
28 0.06
29 0.08
30 0.11
31 0.14
32 0.22
33 0.3
34 0.38
35 0.47
36 0.58
37 0.68
38 0.75
39 0.83
40 0.84
41 0.88
42 0.87
43 0.88
44 0.88
45 0.8