Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z4T4

Protein Details
Accession A0A0C9Z4T4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-46KENGDSRLARRRRRKVKAVALRRLPBasic
53-81LVTPAPPPPKRPPVRRKRRGERTGSCFSPHydrophilic
NLS Segment(s)
PositionSequence
19-73KREKENGDSRLARRRRRKVKAVALRRLPSSERRVLVTPAPPPPKRPPVRRKRRGE
Subcellular Location(s) mito 22, nucl 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MAKAVLRVLAKMVSRELMKREKENGDSRLARRRRRKVKAVALRRLPSSERRVLVTPAPPPPKRPPVRRKRRGERTGSCFSPSRTSQCYVSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.28
4 0.32
5 0.35
6 0.38
7 0.42
8 0.44
9 0.49
10 0.52
11 0.49
12 0.49
13 0.5
14 0.49
15 0.53
16 0.55
17 0.58
18 0.61
19 0.69
20 0.72
21 0.75
22 0.81
23 0.81
24 0.85
25 0.86
26 0.85
27 0.83
28 0.8
29 0.73
30 0.64
31 0.56
32 0.48
33 0.43
34 0.39
35 0.35
36 0.29
37 0.29
38 0.3
39 0.29
40 0.3
41 0.28
42 0.25
43 0.29
44 0.36
45 0.34
46 0.38
47 0.44
48 0.51
49 0.57
50 0.64
51 0.67
52 0.71
53 0.82
54 0.87
55 0.9
56 0.91
57 0.93
58 0.92
59 0.92
60 0.9
61 0.86
62 0.84
63 0.76
64 0.68
65 0.61
66 0.54
67 0.51
68 0.46
69 0.44
70 0.4
71 0.42