Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0A3I9

Protein Details
Accession A0A0D0A3I9    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
116-137HDIHWFQLRKDKNRRCPECGSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002124  Cyt_c_oxidase_su5b  
IPR036972  Cyt_c_oxidase_su5b_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005751  C:mitochondrial respiratory chain complex IV  
GO:0006123  P:mitochondrial electron transport, cytochrome c to oxygen  
Pfam View protein in Pfam  
PF01215  COX5B  
PROSITE View protein in PROSITE  
PS51359  COX5B_2  
PS00028  ZINC_FINGER_C2H2_1  
CDD cd00924  Cyt_c_Oxidase_Vb  
Amino Acid Sequences MFNASLRAVRPLALRATRSAQSSAIRRLSTTSAVRSDHHAPAIFGPGGKPGEIATDEQQATGLERFQLLGEIQGVDAFDKAPLDSSRVGTLEDPIKVFSLDTERLVGCTGSPADSHDIHWFQLRKDKNRRCPECGSTYALDYQGHPHEDVHHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.35
4 0.36
5 0.36
6 0.35
7 0.31
8 0.32
9 0.36
10 0.4
11 0.4
12 0.37
13 0.35
14 0.36
15 0.35
16 0.35
17 0.33
18 0.29
19 0.28
20 0.3
21 0.3
22 0.32
23 0.35
24 0.31
25 0.3
26 0.27
27 0.24
28 0.23
29 0.26
30 0.21
31 0.16
32 0.14
33 0.15
34 0.15
35 0.14
36 0.13
37 0.09
38 0.11
39 0.12
40 0.13
41 0.11
42 0.16
43 0.16
44 0.15
45 0.16
46 0.14
47 0.14
48 0.12
49 0.11
50 0.06
51 0.06
52 0.07
53 0.06
54 0.07
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.06
69 0.06
70 0.08
71 0.09
72 0.1
73 0.11
74 0.11
75 0.12
76 0.1
77 0.13
78 0.13
79 0.13
80 0.12
81 0.12
82 0.12
83 0.11
84 0.11
85 0.09
86 0.12
87 0.12
88 0.12
89 0.14
90 0.13
91 0.13
92 0.14
93 0.13
94 0.08
95 0.09
96 0.09
97 0.08
98 0.08
99 0.1
100 0.13
101 0.14
102 0.16
103 0.19
104 0.19
105 0.2
106 0.26
107 0.25
108 0.23
109 0.31
110 0.37
111 0.42
112 0.52
113 0.62
114 0.66
115 0.76
116 0.81
117 0.8
118 0.8
119 0.78
120 0.74
121 0.67
122 0.62
123 0.52
124 0.47
125 0.43
126 0.37
127 0.31
128 0.24
129 0.26
130 0.26
131 0.26
132 0.25
133 0.23