Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZTR5

Protein Details
Accession A0A0C9ZTR5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-24RVTLRKRQPYNTSSNRRRVVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTLRKRQPYNTSSNRRRVVKTPGGRLVYHHLKKIPTQPKCGDCGIGLPGIPALRPRQYATVSKRIKTVRRAYGGSRCGDCVKSRILRAFLVEEAKIVKRVIKSQQQQKVAQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.79
4 0.81
5 0.8
6 0.77
7 0.74
8 0.69
9 0.68
10 0.68
11 0.66
12 0.65
13 0.65
14 0.62
15 0.58
16 0.55
17 0.54
18 0.54
19 0.49
20 0.44
21 0.39
22 0.37
23 0.41
24 0.49
25 0.5
26 0.44
27 0.49
28 0.51
29 0.51
30 0.53
31 0.49
32 0.4
33 0.3
34 0.27
35 0.21
36 0.15
37 0.12
38 0.09
39 0.09
40 0.07
41 0.07
42 0.07
43 0.08
44 0.1
45 0.11
46 0.12
47 0.15
48 0.18
49 0.25
50 0.29
51 0.38
52 0.39
53 0.39
54 0.43
55 0.46
56 0.49
57 0.5
58 0.53
59 0.51
60 0.52
61 0.54
62 0.53
63 0.56
64 0.54
65 0.49
66 0.41
67 0.35
68 0.33
69 0.32
70 0.29
71 0.23
72 0.26
73 0.27
74 0.3
75 0.32
76 0.33
77 0.32
78 0.33
79 0.33
80 0.28
81 0.27
82 0.23
83 0.19
84 0.2
85 0.2
86 0.2
87 0.18
88 0.2
89 0.2
90 0.26
91 0.34
92 0.42
93 0.5
94 0.58
95 0.66
96 0.69