Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z7L7

Protein Details
Accession A0A0C9Z7L7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAPDCPHPQRDKNKAAKSKKKVTLTKEHydrophilic
NLS Segment(s)
PositionSequence
14-20KAAKSKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.833, cyto 3, cyto_pero 2.833, mito 2
Family & Domain DBs
Amino Acid Sequences MAPDCPHPQRDKNKAAKSKKKVTLTKEQSEEPDEEKIVNGNHEHKETSDHKEGSQYDEGSLIKEYEVYLEVDDDDEPVAYFGAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.88
4 0.87
5 0.88
6 0.86
7 0.85
8 0.82
9 0.79
10 0.79
11 0.77
12 0.75
13 0.68
14 0.61
15 0.53
16 0.49
17 0.44
18 0.35
19 0.28
20 0.21
21 0.17
22 0.16
23 0.15
24 0.12
25 0.12
26 0.11
27 0.13
28 0.15
29 0.16
30 0.16
31 0.14
32 0.2
33 0.22
34 0.27
35 0.3
36 0.29
37 0.28
38 0.33
39 0.33
40 0.33
41 0.33
42 0.27
43 0.21
44 0.22
45 0.22
46 0.18
47 0.18
48 0.13
49 0.09
50 0.09
51 0.09
52 0.08
53 0.09
54 0.09
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07