Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZFL3

Protein Details
Accession A0A0C9ZFL3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-86EKDEEMRRSRRRDKERERDKERRERERERKRASLBasic
NLS Segment(s)
PositionSequence
59-85RRSRRRDKERERDKERRERERERKRAS
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences MSLVMPTHAFAYHPFKQRRRTATDVLAGNFDIRPPRDVLTSLLNGVGPCKDAEKDEEMRRSRRRDKERERDKERRERERERKRASLATADKRPSADPPNTSHPSPPAPAQTIISQSAQTSSFWRARGTSQRPTINIATNQRSVSVTPPPMVSSPRSTPGPSSSSVTSRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.61
4 0.69
5 0.73
6 0.73
7 0.72
8 0.7
9 0.67
10 0.67
11 0.62
12 0.54
13 0.47
14 0.39
15 0.33
16 0.26
17 0.21
18 0.19
19 0.16
20 0.17
21 0.18
22 0.19
23 0.19
24 0.21
25 0.21
26 0.22
27 0.22
28 0.2
29 0.18
30 0.17
31 0.16
32 0.15
33 0.13
34 0.09
35 0.08
36 0.09
37 0.09
38 0.1
39 0.13
40 0.17
41 0.23
42 0.28
43 0.36
44 0.39
45 0.46
46 0.52
47 0.57
48 0.62
49 0.66
50 0.7
51 0.73
52 0.8
53 0.83
54 0.87
55 0.89
56 0.89
57 0.89
58 0.87
59 0.87
60 0.84
61 0.84
62 0.81
63 0.81
64 0.83
65 0.84
66 0.85
67 0.81
68 0.78
69 0.71
70 0.66
71 0.57
72 0.54
73 0.5
74 0.46
75 0.45
76 0.41
77 0.39
78 0.36
79 0.35
80 0.3
81 0.29
82 0.26
83 0.23
84 0.26
85 0.34
86 0.36
87 0.36
88 0.33
89 0.31
90 0.3
91 0.29
92 0.26
93 0.22
94 0.21
95 0.21
96 0.22
97 0.21
98 0.21
99 0.21
100 0.2
101 0.17
102 0.14
103 0.15
104 0.14
105 0.13
106 0.13
107 0.16
108 0.18
109 0.19
110 0.2
111 0.2
112 0.25
113 0.34
114 0.38
115 0.42
116 0.46
117 0.5
118 0.5
119 0.54
120 0.52
121 0.48
122 0.47
123 0.46
124 0.44
125 0.42
126 0.41
127 0.38
128 0.36
129 0.3
130 0.28
131 0.28
132 0.25
133 0.23
134 0.24
135 0.25
136 0.26
137 0.28
138 0.28
139 0.27
140 0.29
141 0.33
142 0.35
143 0.35
144 0.36
145 0.38
146 0.38
147 0.34
148 0.34
149 0.32