Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZWX7

Protein Details
Accession A0A0C9ZWX7   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MGRSAKVHKRVKQTKKPQSQPAPPEPKSHydrophilic
NLS Segment(s)
PositionSequence
6-31KVHKRVKQTKKPQSQPAPPEPKSKAK
46-64KKRADLRSKAKSKGKSAAK
Subcellular Location(s) nucl 16, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MGRSAKVHKRVKQTKKPQSQPAPPEPKSKAKSSGSTVMETVVQSAKKRADLRSKAKSKGKSAAKGADGGHVLAGADYVTLMMGGRRKAAAEALKLPPKDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.92
4 0.91
5 0.9
6 0.89
7 0.86
8 0.86
9 0.85
10 0.77
11 0.75
12 0.7
13 0.69
14 0.64
15 0.59
16 0.56
17 0.51
18 0.52
19 0.49
20 0.53
21 0.45
22 0.42
23 0.38
24 0.31
25 0.27
26 0.22
27 0.18
28 0.12
29 0.11
30 0.11
31 0.13
32 0.14
33 0.18
34 0.21
35 0.25
36 0.33
37 0.4
38 0.47
39 0.54
40 0.59
41 0.61
42 0.65
43 0.66
44 0.6
45 0.61
46 0.6
47 0.56
48 0.55
49 0.52
50 0.47
51 0.44
52 0.4
53 0.34
54 0.28
55 0.22
56 0.17
57 0.12
58 0.11
59 0.07
60 0.07
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.05
69 0.08
70 0.09
71 0.11
72 0.12
73 0.12
74 0.13
75 0.19
76 0.23
77 0.24
78 0.3
79 0.37
80 0.43