Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YI97

Protein Details
Accession A0A0C9YI97    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
50-69ETKRKEQYSAPRPPRPRSGKBasic
NLS Segment(s)
PositionSequence
61-69RPPRPRSGK
Subcellular Location(s) nucl 13, mito 8, pero 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MTSDVPRPKQDGKAGHLYHDLATNLSPAQLIAEAWQRESAQTQEFWRQAETKRKEQYSAPRPPRPRSGKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.47
4 0.41
5 0.35
6 0.31
7 0.26
8 0.16
9 0.15
10 0.13
11 0.11
12 0.1
13 0.09
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.11
20 0.1
21 0.11
22 0.12
23 0.12
24 0.12
25 0.13
26 0.13
27 0.1
28 0.11
29 0.14
30 0.19
31 0.2
32 0.21
33 0.22
34 0.23
35 0.28
36 0.37
37 0.41
38 0.44
39 0.51
40 0.53
41 0.53
42 0.57
43 0.62
44 0.61
45 0.66
46 0.66
47 0.68
48 0.73
49 0.77
50 0.81