Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZI91

Protein Details
Accession A0A0C9ZI91   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
66-91LVGILSRQVRQRRKRQDRAWYRSLPQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, plas 6, nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLRPPFNSLRVIPPHQSRKGFTLPLPVFCGRISVYPGMPRHTKTRQCRGLMLNTITPLSVFPACVLVGILSRQVRQRRKRQDRAWYRSLPQKYMREALANSLTTAGIPPLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.62
4 0.57
5 0.56
6 0.57
7 0.53
8 0.45
9 0.47
10 0.41
11 0.4
12 0.42
13 0.36
14 0.31
15 0.28
16 0.28
17 0.18
18 0.18
19 0.18
20 0.15
21 0.16
22 0.2
23 0.22
24 0.24
25 0.26
26 0.26
27 0.3
28 0.37
29 0.45
30 0.48
31 0.57
32 0.6
33 0.6
34 0.62
35 0.58
36 0.55
37 0.51
38 0.45
39 0.35
40 0.28
41 0.26
42 0.21
43 0.17
44 0.12
45 0.09
46 0.07
47 0.06
48 0.05
49 0.06
50 0.07
51 0.06
52 0.07
53 0.05
54 0.05
55 0.06
56 0.09
57 0.09
58 0.1
59 0.16
60 0.25
61 0.34
62 0.43
63 0.53
64 0.62
65 0.72
66 0.81
67 0.84
68 0.87
69 0.89
70 0.88
71 0.86
72 0.8
73 0.74
74 0.72
75 0.68
76 0.63
77 0.6
78 0.58
79 0.54
80 0.52
81 0.5
82 0.45
83 0.41
84 0.42
85 0.39
86 0.33
87 0.28
88 0.25
89 0.23
90 0.18
91 0.19