Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZM82

Protein Details
Accession A0A0C9ZM82   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-124AMTHKKQDCLERPRKKGAKFBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 6, pero 5, mito 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039974  Splicing_factor_SLU7  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0030628  F:pre-mRNA 3'-splice site binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Amino Acid Sequences MASASAIGKLSREEFRRQKDLEAARKAGTAPAALDEEGKPINPHIPQYISQAPWYLDTGAPSLSHQRRPAAAKPPSEIDSWYDRGARAGPAAKKYRKGACENCGAMTHKKQDCLERPRKKGAKFTNKDIQADEDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.56
4 0.55
5 0.55
6 0.57
7 0.63
8 0.63
9 0.6
10 0.55
11 0.48
12 0.47
13 0.44
14 0.37
15 0.28
16 0.19
17 0.13
18 0.12
19 0.12
20 0.12
21 0.13
22 0.11
23 0.12
24 0.12
25 0.12
26 0.1
27 0.1
28 0.13
29 0.13
30 0.14
31 0.15
32 0.17
33 0.18
34 0.24
35 0.27
36 0.24
37 0.24
38 0.24
39 0.22
40 0.2
41 0.2
42 0.15
43 0.11
44 0.11
45 0.11
46 0.1
47 0.09
48 0.09
49 0.16
50 0.18
51 0.21
52 0.22
53 0.23
54 0.25
55 0.29
56 0.34
57 0.35
58 0.37
59 0.36
60 0.36
61 0.37
62 0.36
63 0.32
64 0.28
65 0.22
66 0.21
67 0.21
68 0.21
69 0.19
70 0.17
71 0.17
72 0.18
73 0.15
74 0.13
75 0.17
76 0.18
77 0.25
78 0.33
79 0.36
80 0.4
81 0.45
82 0.5
83 0.5
84 0.56
85 0.56
86 0.53
87 0.57
88 0.53
89 0.49
90 0.46
91 0.44
92 0.4
93 0.39
94 0.43
95 0.37
96 0.41
97 0.42
98 0.48
99 0.54
100 0.6
101 0.65
102 0.66
103 0.7
104 0.76
105 0.81
106 0.77
107 0.78
108 0.78
109 0.78
110 0.75
111 0.77
112 0.76
113 0.74
114 0.71
115 0.63