Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DFB9

Protein Details
Accession E9DFB9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
102-124VEWFKKFMGKRRRRTEGNEELDKBasic
NLS Segment(s)
PositionSequence
109-120MGKRRRRTEGNE
122-128LDKRIRR
Subcellular Location(s) plas 16, nucl 3, cyto 3, cyto_nucl 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027443  IPNS-like_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNLNFRLRDYTPATTEPDGPNGCGVYTDNGTFSIIFQDGTVSLEVKSPSAPGTWLFVLCGWCTLILTGGTVYAARHRTCTLKPIGSAEKQFSSEIMNGKVAVEWFKKFMGKRRRRTEGNEELDKRIRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.35
4 0.36
5 0.32
6 0.28
7 0.27
8 0.23
9 0.21
10 0.17
11 0.16
12 0.13
13 0.13
14 0.13
15 0.12
16 0.12
17 0.13
18 0.12
19 0.11
20 0.11
21 0.09
22 0.09
23 0.08
24 0.08
25 0.07
26 0.09
27 0.09
28 0.07
29 0.07
30 0.09
31 0.1
32 0.09
33 0.09
34 0.08
35 0.09
36 0.08
37 0.09
38 0.07
39 0.1
40 0.1
41 0.1
42 0.09
43 0.1
44 0.11
45 0.1
46 0.1
47 0.07
48 0.06
49 0.06
50 0.06
51 0.05
52 0.04
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.07
60 0.11
61 0.11
62 0.13
63 0.14
64 0.18
65 0.18
66 0.24
67 0.25
68 0.24
69 0.25
70 0.28
71 0.32
72 0.32
73 0.34
74 0.31
75 0.28
76 0.28
77 0.27
78 0.22
79 0.2
80 0.19
81 0.2
82 0.18
83 0.17
84 0.16
85 0.16
86 0.16
87 0.14
88 0.16
89 0.16
90 0.16
91 0.17
92 0.19
93 0.24
94 0.26
95 0.35
96 0.42
97 0.49
98 0.59
99 0.67
100 0.75
101 0.77
102 0.82
103 0.83
104 0.82
105 0.8
106 0.8
107 0.73
108 0.7