Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZPR4

Protein Details
Accession A0A0C9ZPR4    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-65TVRSSRERTKHEQRNKGRVGBasic
NLS Segment(s)
PositionSequence
40-56ARSNPKTVRSSRERTKH
Subcellular Location(s) nucl 17, cyto 7, mito 2
Family & Domain DBs
Amino Acid Sequences MTLFHPTRDNRDREQPRRQGFNMFSQRDGDRVSGGHRRTARSNPKTVRSSRERTKHEQRNKGRVGDTHVPLMVKVKRALGIPEHTQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.74
4 0.77
5 0.72
6 0.69
7 0.62
8 0.63
9 0.63
10 0.55
11 0.48
12 0.44
13 0.43
14 0.36
15 0.35
16 0.25
17 0.15
18 0.14
19 0.17
20 0.2
21 0.21
22 0.25
23 0.25
24 0.28
25 0.31
26 0.39
27 0.46
28 0.45
29 0.52
30 0.51
31 0.56
32 0.59
33 0.57
34 0.56
35 0.52
36 0.55
37 0.56
38 0.61
39 0.6
40 0.63
41 0.71
42 0.74
43 0.76
44 0.79
45 0.79
46 0.81
47 0.79
48 0.75
49 0.67
50 0.59
51 0.58
52 0.56
53 0.49
54 0.41
55 0.37
56 0.32
57 0.3
58 0.34
59 0.29
60 0.25
61 0.24
62 0.24
63 0.25
64 0.26
65 0.3
66 0.29
67 0.32