Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9D7I6

Protein Details
Accession E9D7I6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-37AVRLTFCRREPRKYSRCRKACFCTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 12
Family & Domain DBs
Amino Acid Sequences MGKRVPEVAGSVVAVRLTFCRREPRKYSRCRKACFCTILRHGRRCHWGWATSQPLTGRRETARQARQHGGTANLDGVKASGLAGQGSGLTAQHWFLETS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.11
4 0.13
5 0.15
6 0.18
7 0.29
8 0.34
9 0.43
10 0.51
11 0.59
12 0.65
13 0.74
14 0.81
15 0.81
16 0.85
17 0.83
18 0.83
19 0.79
20 0.77
21 0.73
22 0.65
23 0.62
24 0.61
25 0.65
26 0.63
27 0.62
28 0.56
29 0.54
30 0.57
31 0.52
32 0.5
33 0.43
34 0.38
35 0.34
36 0.38
37 0.37
38 0.31
39 0.31
40 0.26
41 0.28
42 0.28
43 0.26
44 0.23
45 0.2
46 0.24
47 0.27
48 0.34
49 0.37
50 0.4
51 0.45
52 0.47
53 0.47
54 0.45
55 0.42
56 0.37
57 0.3
58 0.26
59 0.23
60 0.18
61 0.16
62 0.13
63 0.12
64 0.08
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.06
78 0.07
79 0.07