Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XMP4

Protein Details
Accession A0A0C9XMP4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-27RLSKASRRPLTPKRGNKDFYKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MFPTAARLSKASRRPLTPKRGNKDFYKGTRQAVLPGGLRTGAPGRFIVRGSGKYRLLDEKVRVFVAPHISEINQCELKPYVHTETHVTSSQRKDLYSLMPLAPGAPSPRWRETRVTNRLVSVASKGKEVPTALPEDGAKGGVLQWFKGITSRKEKTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.76
4 0.77
5 0.8
6 0.79
7 0.82
8 0.81
9 0.77
10 0.76
11 0.74
12 0.71
13 0.7
14 0.65
15 0.59
16 0.59
17 0.53
18 0.48
19 0.42
20 0.38
21 0.3
22 0.26
23 0.24
24 0.19
25 0.18
26 0.16
27 0.16
28 0.13
29 0.12
30 0.13
31 0.14
32 0.15
33 0.16
34 0.18
35 0.18
36 0.22
37 0.24
38 0.29
39 0.29
40 0.28
41 0.3
42 0.31
43 0.31
44 0.3
45 0.31
46 0.29
47 0.29
48 0.28
49 0.26
50 0.22
51 0.22
52 0.23
53 0.2
54 0.16
55 0.15
56 0.15
57 0.16
58 0.17
59 0.18
60 0.13
61 0.13
62 0.13
63 0.14
64 0.14
65 0.14
66 0.16
67 0.16
68 0.15
69 0.16
70 0.17
71 0.18
72 0.2
73 0.22
74 0.21
75 0.21
76 0.23
77 0.27
78 0.25
79 0.24
80 0.22
81 0.21
82 0.22
83 0.2
84 0.2
85 0.16
86 0.15
87 0.15
88 0.13
89 0.11
90 0.1
91 0.1
92 0.11
93 0.16
94 0.21
95 0.27
96 0.31
97 0.34
98 0.39
99 0.45
100 0.54
101 0.57
102 0.57
103 0.52
104 0.49
105 0.48
106 0.43
107 0.35
108 0.29
109 0.27
110 0.22
111 0.22
112 0.22
113 0.22
114 0.24
115 0.24
116 0.22
117 0.18
118 0.22
119 0.21
120 0.22
121 0.21
122 0.2
123 0.19
124 0.17
125 0.14
126 0.09
127 0.1
128 0.12
129 0.13
130 0.11
131 0.13
132 0.13
133 0.13
134 0.19
135 0.24
136 0.28
137 0.37