Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9CZG6

Protein Details
Accession E9CZG6    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-58MPRWTDRSPSPRREERRRSRSRSPRRRRYDDDRDRDRGRKKQSGFRWKEKPRRDDDISBasic
115-146DTERNRSKEDRDRKERKPKEKKEKKPAGPAEPBasic
NLS Segment(s)
PositionSequence
9-142PSPRREERRRSRSRSPRRRRYDDDRDRDRGRKKQSGFRWKEKPRRDDDISGREPERGLERGYRERDRARSPFRDRDRDYGRGRERYRDGDRDRRPSDRDRDRAPDRDTERNRSKEDRDRKERKPKEKKEKKPAG
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences MPRWTDRSPSPRREERRRSRSRSPRRRRYDDDRDRDRGRKKQSGFRWKEKPRRDDDISGREPERGLERGYRERDRARSPFRDRDRDYGRGRERYRDGDRDRRPSDRDRDRAPDRDTERNRSKEDRDRKERKPKEKKEKKPAGPAEPMIVVHVNDRLGTKAAIPCLASDPIRLFKAQVAARIGREPHEILLKRQGERPFKDQLTLEDYGVSNGVQLDLEVDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.9
5 0.9
6 0.91
7 0.92
8 0.93
9 0.93
10 0.93
11 0.93
12 0.92
13 0.93
14 0.91
15 0.9
16 0.9
17 0.9
18 0.89
19 0.86
20 0.84
21 0.81
22 0.81
23 0.79
24 0.76
25 0.74
26 0.73
27 0.7
28 0.72
29 0.76
30 0.79
31 0.79
32 0.8
33 0.81
34 0.83
35 0.87
36 0.87
37 0.85
38 0.81
39 0.81
40 0.77
41 0.75
42 0.73
43 0.72
44 0.66
45 0.61
46 0.55
47 0.47
48 0.41
49 0.33
50 0.29
51 0.21
52 0.19
53 0.19
54 0.24
55 0.31
56 0.37
57 0.4
58 0.41
59 0.45
60 0.49
61 0.52
62 0.55
63 0.55
64 0.58
65 0.62
66 0.67
67 0.68
68 0.72
69 0.69
70 0.69
71 0.67
72 0.66
73 0.62
74 0.62
75 0.61
76 0.6
77 0.58
78 0.55
79 0.53
80 0.52
81 0.54
82 0.54
83 0.53
84 0.55
85 0.6
86 0.62
87 0.62
88 0.58
89 0.57
90 0.55
91 0.59
92 0.58
93 0.56
94 0.52
95 0.56
96 0.57
97 0.59
98 0.54
99 0.52
100 0.47
101 0.51
102 0.51
103 0.52
104 0.55
105 0.53
106 0.55
107 0.52
108 0.54
109 0.54
110 0.61
111 0.62
112 0.65
113 0.69
114 0.74
115 0.81
116 0.84
117 0.86
118 0.87
119 0.87
120 0.88
121 0.91
122 0.92
123 0.92
124 0.93
125 0.89
126 0.89
127 0.85
128 0.8
129 0.74
130 0.64
131 0.54
132 0.45
133 0.37
134 0.28
135 0.22
136 0.15
137 0.11
138 0.11
139 0.1
140 0.09
141 0.1
142 0.1
143 0.1
144 0.1
145 0.12
146 0.13
147 0.13
148 0.14
149 0.14
150 0.13
151 0.15
152 0.17
153 0.15
154 0.15
155 0.17
156 0.19
157 0.2
158 0.2
159 0.17
160 0.17
161 0.24
162 0.24
163 0.26
164 0.27
165 0.28
166 0.3
167 0.33
168 0.32
169 0.27
170 0.29
171 0.25
172 0.23
173 0.29
174 0.29
175 0.28
176 0.37
177 0.4
178 0.38
179 0.43
180 0.5
181 0.5
182 0.54
183 0.55
184 0.55
185 0.51
186 0.53
187 0.48
188 0.44
189 0.42
190 0.38
191 0.34
192 0.27
193 0.26
194 0.23
195 0.22
196 0.17
197 0.11
198 0.1
199 0.1
200 0.07
201 0.07
202 0.07
203 0.07