Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZNT0

Protein Details
Accession A0A0C9ZNT0    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-28IAYVPPSTRKGRRFPRHRLIPRTQTLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MIAYVPPSTRKGRRFPRHRLIPRTQTLTLLSGSGSYGERDGDGCRRVSVQRQVRWTSTANRNRTASRVSLSYSDCYIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.84
4 0.87
5 0.9
6 0.88
7 0.87
8 0.85
9 0.81
10 0.77
11 0.67
12 0.57
13 0.49
14 0.41
15 0.32
16 0.23
17 0.16
18 0.1
19 0.09
20 0.08
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.08
28 0.1
29 0.11
30 0.12
31 0.12
32 0.14
33 0.15
34 0.21
35 0.29
36 0.35
37 0.38
38 0.44
39 0.48
40 0.48
41 0.5
42 0.47
43 0.46
44 0.47
45 0.51
46 0.49
47 0.52
48 0.53
49 0.52
50 0.52
51 0.48
52 0.4
53 0.35
54 0.32
55 0.29
56 0.3
57 0.31
58 0.3