Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZGI7

Protein Details
Accession A0A0C9ZGI7    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-65PKTARVCKEKWKRLRKMFEVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, nucl 7, cyto_nucl 6.5, pero 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences WTDADVDVLLDLAIAHKASAGEWMNFKAMFWNTASAALSNPARGGPKTARVCKEKWKRLRKMFEVVNCIKNTLGFAYLNELGANISLENEAMWSDFVKKHKDIDPFQNRGWLHYKKMKQLMPSKGKGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.06
6 0.12
7 0.14
8 0.15
9 0.17
10 0.18
11 0.2
12 0.19
13 0.19
14 0.18
15 0.17
16 0.17
17 0.16
18 0.17
19 0.15
20 0.17
21 0.18
22 0.13
23 0.12
24 0.14
25 0.13
26 0.11
27 0.11
28 0.1
29 0.12
30 0.12
31 0.16
32 0.15
33 0.24
34 0.31
35 0.37
36 0.42
37 0.44
38 0.47
39 0.53
40 0.61
41 0.61
42 0.64
43 0.69
44 0.73
45 0.78
46 0.84
47 0.78
48 0.75
49 0.7
50 0.65
51 0.62
52 0.55
53 0.51
54 0.42
55 0.37
56 0.3
57 0.25
58 0.21
59 0.13
60 0.12
61 0.07
62 0.07
63 0.11
64 0.11
65 0.11
66 0.11
67 0.1
68 0.08
69 0.08
70 0.08
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.08
82 0.12
83 0.16
84 0.21
85 0.22
86 0.26
87 0.32
88 0.39
89 0.42
90 0.5
91 0.56
92 0.56
93 0.56
94 0.58
95 0.52
96 0.49
97 0.52
98 0.45
99 0.43
100 0.47
101 0.52
102 0.54
103 0.63
104 0.62
105 0.63
106 0.68
107 0.71
108 0.71
109 0.7