Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DGT0

Protein Details
Accession E9DGT0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-32SSYLDIRCSRRLRRRNRRELRHSHRILTHydrophilic
NLS Segment(s)
PositionSequence
15-24RLRRRNRREL
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
Amino Acid Sequences MLKMSSYLDIRCSRRLRRRNRRELRHSHRILTRDGLHAKDLCTISTGFTNEERIYFESWPGHAVVAETMETPGTVLSFPAFQVVTSYGTAYTTCETSEVETANANPHRNAGSGVTVSRPLRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.7
3 0.75
4 0.79
5 0.86
6 0.89
7 0.93
8 0.93
9 0.93
10 0.94
11 0.92
12 0.92
13 0.84
14 0.8
15 0.74
16 0.66
17 0.58
18 0.52
19 0.45
20 0.41
21 0.4
22 0.34
23 0.32
24 0.3
25 0.28
26 0.28
27 0.25
28 0.19
29 0.17
30 0.16
31 0.14
32 0.15
33 0.15
34 0.11
35 0.12
36 0.14
37 0.13
38 0.13
39 0.14
40 0.14
41 0.15
42 0.14
43 0.15
44 0.12
45 0.12
46 0.13
47 0.11
48 0.09
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.06
67 0.06
68 0.05
69 0.07
70 0.08
71 0.1
72 0.1
73 0.1
74 0.09
75 0.09
76 0.1
77 0.1
78 0.1
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.12
85 0.12
86 0.11
87 0.12
88 0.12
89 0.19
90 0.23
91 0.23
92 0.21
93 0.23
94 0.24
95 0.23
96 0.24
97 0.19
98 0.19
99 0.19
100 0.2
101 0.2
102 0.24
103 0.24