Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9Y8K8

Protein Details
Accession A0A0C9Y8K8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-61RHQPQRFYLPPHKREKKPTIKLSLESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
Amino Acid Sequences MSIVDSYHNMSDACLSPLDDPSPSLNLLCLAQTPYRHQPQRFYLPPHKREKKPTIKLSLES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.14
5 0.15
6 0.12
7 0.12
8 0.12
9 0.13
10 0.12
11 0.11
12 0.1
13 0.1
14 0.1
15 0.08
16 0.07
17 0.08
18 0.09
19 0.1
20 0.15
21 0.21
22 0.29
23 0.35
24 0.36
25 0.4
26 0.46
27 0.54
28 0.55
29 0.57
30 0.59
31 0.64
32 0.71
33 0.76
34 0.78
35 0.76
36 0.81
37 0.84
38 0.84
39 0.84
40 0.86
41 0.84