Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YLJ1

Protein Details
Accession A0A0C9YLJ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-28SIQICTRKIHRKGITHRKGCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MRFVGNYLSIQICTRKIHRKGITHRKGCQCLATASPCRWILLIAPRSLVAMKPLQVRVACKVTLQAISLELPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.41
4 0.5
5 0.56
6 0.62
7 0.7
8 0.77
9 0.8
10 0.77
11 0.8
12 0.78
13 0.75
14 0.67
15 0.58
16 0.49
17 0.4
18 0.36
19 0.34
20 0.28
21 0.24
22 0.27
23 0.24
24 0.22
25 0.2
26 0.18
27 0.15
28 0.2
29 0.23
30 0.19
31 0.19
32 0.19
33 0.2
34 0.2
35 0.18
36 0.12
37 0.11
38 0.14
39 0.18
40 0.18
41 0.22
42 0.23
43 0.26
44 0.28
45 0.3
46 0.27
47 0.23
48 0.25
49 0.24
50 0.24
51 0.23
52 0.18
53 0.16