Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YRT7

Protein Details
Accession A0A0C9YRT7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-30PVRIRIPWRRDKPTRMLRDGBasic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 6, mito_nucl 6, plas 4
Family & Domain DBs
Amino Acid Sequences MFDKTIGGIIPVRIRIPWRRDKPTRMLRDGSMAAGLFVSLPTLALNTFQDLLARDQQLSTGVPPSTTSQGLSFRNISDTVQITLPVVQGTVAAVPAVGAPLAAAIGGLLAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.37
4 0.45
5 0.51
6 0.59
7 0.67
8 0.73
9 0.78
10 0.8
11 0.8
12 0.76
13 0.7
14 0.61
15 0.58
16 0.51
17 0.41
18 0.32
19 0.23
20 0.16
21 0.13
22 0.11
23 0.06
24 0.05
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.05
33 0.06
34 0.07
35 0.06
36 0.07
37 0.08
38 0.11
39 0.13
40 0.13
41 0.12
42 0.11
43 0.12
44 0.12
45 0.11
46 0.09
47 0.09
48 0.08
49 0.08
50 0.09
51 0.11
52 0.13
53 0.13
54 0.13
55 0.12
56 0.17
57 0.18
58 0.2
59 0.19
60 0.17
61 0.19
62 0.19
63 0.17
64 0.15
65 0.16
66 0.14
67 0.14
68 0.14
69 0.12
70 0.12
71 0.12
72 0.09
73 0.08
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02