Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DC24

Protein Details
Accession E9DC24    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
17-36SLVSEKKKPGRKPSALKEEPHydrophilic
NLS Segment(s)
PositionSequence
22-28KKKPGRK
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAPRTQKSAAQDEHSFSLVSEKKKPGRKPSALKEEPTMGNTVCSCCLMFMYTAHIDKPCCCKQEIAKICTNYTEDKKASVLEKLVPIQAEQKKLVEYIFYSVKID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.24
4 0.29
5 0.27
6 0.28
7 0.32
8 0.37
9 0.44
10 0.52
11 0.6
12 0.62
13 0.68
14 0.73
15 0.76
16 0.79
17 0.83
18 0.78
19 0.72
20 0.64
21 0.58
22 0.5
23 0.41
24 0.33
25 0.22
26 0.19
27 0.18
28 0.16
29 0.11
30 0.11
31 0.09
32 0.08
33 0.08
34 0.07
35 0.07
36 0.06
37 0.1
38 0.11
39 0.11
40 0.12
41 0.13
42 0.13
43 0.15
44 0.22
45 0.22
46 0.22
47 0.23
48 0.25
49 0.29
50 0.39
51 0.45
52 0.42
53 0.44
54 0.44
55 0.44
56 0.43
57 0.4
58 0.35
59 0.31
60 0.32
61 0.27
62 0.26
63 0.27
64 0.27
65 0.27
66 0.24
67 0.22
68 0.19
69 0.22
70 0.22
71 0.23
72 0.21
73 0.2
74 0.26
75 0.29
76 0.3
77 0.29
78 0.29
79 0.28
80 0.29
81 0.28
82 0.22
83 0.19
84 0.19
85 0.21