Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A7X5

Protein Details
Accession A0A0D0A7X5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSLRSKVKRAFRAKKRTEGVYHydrophilic
NLS Segment(s)
PositionSequence
6-18RSKVKRAFRAKKR
96-137RGSRREDWRKSKGMDPVPRRKGMNRQGGLAARRRAGRPSRRR
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKVKRAFRAKKRTEGVYAATEAARLNRLNTILAGISKQRREGSVAGDDPKTLELDSHGGSFTGRIHRLDPTFMAQACPEISNRVSTHGSRGSRREDWRKSKGMDPVPRRKGMNRQGGLAARRRAGRPSRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.88
4 0.82
5 0.77
6 0.71
7 0.64
8 0.57
9 0.49
10 0.43
11 0.35
12 0.29
13 0.24
14 0.2
15 0.17
16 0.16
17 0.13
18 0.12
19 0.13
20 0.14
21 0.14
22 0.14
23 0.14
24 0.11
25 0.11
26 0.12
27 0.14
28 0.18
29 0.19
30 0.22
31 0.22
32 0.22
33 0.25
34 0.25
35 0.24
36 0.25
37 0.26
38 0.25
39 0.24
40 0.23
41 0.2
42 0.19
43 0.16
44 0.1
45 0.07
46 0.06
47 0.08
48 0.09
49 0.09
50 0.08
51 0.07
52 0.07
53 0.08
54 0.09
55 0.11
56 0.11
57 0.12
58 0.13
59 0.16
60 0.16
61 0.17
62 0.16
63 0.15
64 0.16
65 0.16
66 0.15
67 0.12
68 0.13
69 0.12
70 0.12
71 0.09
72 0.1
73 0.1
74 0.13
75 0.14
76 0.17
77 0.19
78 0.18
79 0.23
80 0.27
81 0.3
82 0.31
83 0.35
84 0.38
85 0.42
86 0.5
87 0.56
88 0.59
89 0.65
90 0.68
91 0.71
92 0.67
93 0.66
94 0.66
95 0.66
96 0.65
97 0.66
98 0.69
99 0.7
100 0.71
101 0.69
102 0.66
103 0.67
104 0.67
105 0.68
106 0.59
107 0.54
108 0.56
109 0.58
110 0.58
111 0.56
112 0.5
113 0.44
114 0.47
115 0.46
116 0.49
117 0.53