Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YK91

Protein Details
Accession A0A0C9YK91    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MTSSAKSKSKGKGKDKSKIKCYKCKEVRHTKEKCPQKAHydrophilic
NLS Segment(s)
PositionSequence
6-20KSKSKGKGKDKSKIK
Subcellular Location(s) nucl 18.5, mito_nucl 12, mito 4.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MTSSAKSKSKGKGKDKSKIKCYKCKEVRHTKEKCPQKASGKGKALSDGKEDKEKSGDKGNLTAKVAQVQEVGEQSLQLFMAQKGPVTSPTEWVVDSGSWNHQNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.84
4 0.85
5 0.85
6 0.83
7 0.83
8 0.82
9 0.83
10 0.83
11 0.83
12 0.83
13 0.84
14 0.86
15 0.86
16 0.85
17 0.83
18 0.83
19 0.83
20 0.8
21 0.73
22 0.71
23 0.69
24 0.72
25 0.69
26 0.7
27 0.66
28 0.6
29 0.56
30 0.54
31 0.48
32 0.39
33 0.37
34 0.31
35 0.26
36 0.31
37 0.3
38 0.25
39 0.27
40 0.27
41 0.24
42 0.28
43 0.29
44 0.23
45 0.29
46 0.31
47 0.3
48 0.3
49 0.3
50 0.23
51 0.24
52 0.24
53 0.18
54 0.16
55 0.13
56 0.13
57 0.12
58 0.13
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.06
65 0.07
66 0.07
67 0.11
68 0.11
69 0.12
70 0.12
71 0.14
72 0.17
73 0.2
74 0.2
75 0.2
76 0.22
77 0.23
78 0.22
79 0.21
80 0.19
81 0.15
82 0.17
83 0.16
84 0.21