Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZA35

Protein Details
Accession A0A0C9ZA35    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-58HHIVKRAPKKPPKGKGNAKAQLBasic
NLS Segment(s)
PositionSequence
41-54KRAPKKPPKGKGNA
Subcellular Location(s) cyto 16, cyto_nucl 14, nucl 10
Family & Domain DBs
Amino Acid Sequences MADEDRRCCWTLVSIRDSVYDTSALDSDITDPYQKSHHIVKRAPKKPPKGKGNAKAQLVVPSEISPNASLVNWISIESMISPHVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.37
4 0.38
5 0.3
6 0.24
7 0.18
8 0.13
9 0.13
10 0.12
11 0.11
12 0.09
13 0.08
14 0.08
15 0.09
16 0.09
17 0.09
18 0.09
19 0.1
20 0.11
21 0.12
22 0.13
23 0.21
24 0.24
25 0.3
26 0.34
27 0.42
28 0.51
29 0.57
30 0.63
31 0.63
32 0.69
33 0.72
34 0.78
35 0.78
36 0.77
37 0.81
38 0.8
39 0.83
40 0.79
41 0.71
42 0.63
43 0.55
44 0.52
45 0.44
46 0.36
47 0.26
48 0.2
49 0.2
50 0.18
51 0.18
52 0.12
53 0.1
54 0.1
55 0.09
56 0.09
57 0.09
58 0.11
59 0.1
60 0.1
61 0.1
62 0.09
63 0.1
64 0.09
65 0.1