Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YW75

Protein Details
Accession A0A0C9YW75    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-76GSDAEKRRLRRENRQLLRDKNKFGBasic
NLS Segment(s)
PositionSequence
58-74KRRLRRENRQLLRDKNK
Subcellular Location(s) nucl 16, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences ISSCPAGTVLSGLNYLKGQPPVLAMPDEDYPAWLWDLTNPKSKRHEGEYLGPGSDAEKRRLRRENRQLLRDKNKFGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.15
5 0.14
6 0.13
7 0.15
8 0.15
9 0.16
10 0.15
11 0.12
12 0.13
13 0.13
14 0.14
15 0.11
16 0.11
17 0.1
18 0.1
19 0.1
20 0.07
21 0.07
22 0.09
23 0.16
24 0.17
25 0.26
26 0.27
27 0.3
28 0.36
29 0.39
30 0.38
31 0.37
32 0.41
33 0.36
34 0.42
35 0.42
36 0.38
37 0.36
38 0.32
39 0.27
40 0.22
41 0.25
42 0.2
43 0.22
44 0.28
45 0.32
46 0.4
47 0.5
48 0.57
49 0.62
50 0.7
51 0.75
52 0.78
53 0.83
54 0.84
55 0.85
56 0.88
57 0.84
58 0.79