Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XX88

Protein Details
Accession A0A0C9XX88    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-43GSNVRRRCRYRVHCHRRWESDKREBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.833, nucl 12.5, cyto 10, cyto_pero 5.999
Family & Domain DBs
Amino Acid Sequences MPACPPTCEESGAMGGYEMGSNVRRRCRYRVHCHRRWESDKREVVAVDKWWTAGFTVDECPQFLLALHVTRPGPCPPSSSTRRDLQADLLCCPSADCVVNYRVAQPTVRGGSYSVRSIHNPVLPLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.09
5 0.07
6 0.07
7 0.1
8 0.15
9 0.2
10 0.28
11 0.35
12 0.4
13 0.47
14 0.56
15 0.63
16 0.7
17 0.76
18 0.79
19 0.79
20 0.85
21 0.86
22 0.85
23 0.83
24 0.81
25 0.77
26 0.77
27 0.73
28 0.65
29 0.58
30 0.48
31 0.42
32 0.35
33 0.29
34 0.22
35 0.17
36 0.16
37 0.14
38 0.14
39 0.12
40 0.1
41 0.08
42 0.07
43 0.09
44 0.11
45 0.11
46 0.11
47 0.11
48 0.1
49 0.09
50 0.08
51 0.08
52 0.06
53 0.07
54 0.07
55 0.09
56 0.09
57 0.1
58 0.13
59 0.13
60 0.16
61 0.15
62 0.19
63 0.19
64 0.27
65 0.32
66 0.35
67 0.37
68 0.38
69 0.42
70 0.41
71 0.39
72 0.37
73 0.37
74 0.33
75 0.31
76 0.28
77 0.25
78 0.22
79 0.21
80 0.15
81 0.12
82 0.11
83 0.1
84 0.12
85 0.14
86 0.18
87 0.18
88 0.2
89 0.21
90 0.21
91 0.21
92 0.19
93 0.24
94 0.24
95 0.24
96 0.22
97 0.2
98 0.24
99 0.27
100 0.29
101 0.25
102 0.25
103 0.27
104 0.31
105 0.36
106 0.34