Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YUM4

Protein Details
Accession A0A0C9YUM4   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-123SMYPNQKEADKKPRRPHFQWRHHMRVDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 6, cyto 2, plas 1, pero 1, golg 1
Family & Domain DBs
Amino Acid Sequences IKPESSATTQEIIFLAHQGQSLRGILINFCKNHGIILVTYSKHHWCLQNAIGRHLYAVFPTCAWAVLPLISSGTARNVQEVSLSLMDMKDHPIPSQSMYPNQKEADKKPRRPHFQWRHHMRVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.12
5 0.11
6 0.12
7 0.13
8 0.13
9 0.12
10 0.13
11 0.12
12 0.12
13 0.18
14 0.23
15 0.21
16 0.22
17 0.23
18 0.22
19 0.22
20 0.21
21 0.16
22 0.1
23 0.13
24 0.15
25 0.14
26 0.15
27 0.17
28 0.18
29 0.19
30 0.22
31 0.22
32 0.2
33 0.25
34 0.29
35 0.32
36 0.31
37 0.32
38 0.3
39 0.26
40 0.25
41 0.2
42 0.15
43 0.1
44 0.11
45 0.08
46 0.07
47 0.08
48 0.07
49 0.07
50 0.07
51 0.06
52 0.05
53 0.05
54 0.06
55 0.05
56 0.05
57 0.05
58 0.06
59 0.05
60 0.07
61 0.1
62 0.09
63 0.11
64 0.11
65 0.1
66 0.11
67 0.11
68 0.12
69 0.1
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.11
76 0.12
77 0.12
78 0.13
79 0.15
80 0.16
81 0.18
82 0.24
83 0.24
84 0.29
85 0.35
86 0.38
87 0.4
88 0.41
89 0.45
90 0.44
91 0.5
92 0.52
93 0.57
94 0.63
95 0.7
96 0.78
97 0.82
98 0.83
99 0.87
100 0.87
101 0.87
102 0.88
103 0.88