Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z6Y3

Protein Details
Accession A0A0C9Z6Y3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-99IFYRVLCRRHVRRDIRRVLWCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 6, extr 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNKSRRPSWLEPPIVYLVRSQPSLGILIRRACHPCCASSCSHSFLDRHSDLSNEARPLADKVNALIAIEFLPATHCGVIFYRVLCRRHVRRDIRRVLWCIISPLLPVSGFVFFCSRPVALCHVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.35
4 0.3
5 0.27
6 0.27
7 0.22
8 0.18
9 0.18
10 0.2
11 0.19
12 0.17
13 0.18
14 0.21
15 0.22
16 0.25
17 0.28
18 0.27
19 0.32
20 0.3
21 0.3
22 0.29
23 0.32
24 0.3
25 0.3
26 0.32
27 0.3
28 0.29
29 0.28
30 0.25
31 0.24
32 0.29
33 0.25
34 0.24
35 0.21
36 0.2
37 0.2
38 0.23
39 0.24
40 0.16
41 0.16
42 0.14
43 0.14
44 0.15
45 0.15
46 0.13
47 0.1
48 0.09
49 0.11
50 0.11
51 0.1
52 0.08
53 0.07
54 0.06
55 0.06
56 0.05
57 0.03
58 0.05
59 0.05
60 0.06
61 0.06
62 0.05
63 0.06
64 0.07
65 0.09
66 0.09
67 0.09
68 0.15
69 0.22
70 0.23
71 0.27
72 0.35
73 0.41
74 0.49
75 0.59
76 0.63
77 0.67
78 0.76
79 0.81
80 0.8
81 0.8
82 0.75
83 0.68
84 0.6
85 0.51
86 0.43
87 0.35
88 0.28
89 0.21
90 0.18
91 0.16
92 0.13
93 0.12
94 0.11
95 0.13
96 0.12
97 0.13
98 0.15
99 0.13
100 0.15
101 0.17
102 0.15
103 0.14
104 0.17