Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZF16

Protein Details
Accession A0A0C9ZF16    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-89HASTRRSARRSRRSSRSGSRSRSRSRSPSRERKRRRSKRKEKERDKERRRKDKEKRKEKDERRSVLTBasic
NLS Segment(s)
PositionSequence
27-98RRSARRSRRSSRSGSRSRSRSRSPSRERKRRRSKRKEKERDKERRRKDKEKRKEKDERRSVLTGKKIKLKVH
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MTPSGRHRSQSPDSSVSFNHSDHASTRRSARRSRRSSRSGSRSRSRSRSPSRERKRRRSKRKEKERDKERRRKDKEKRKEKDERRSVLTGKKIKLKVHKDSKDLEMDANRQDLLQFLNSTCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.44
4 0.38
5 0.3
6 0.26
7 0.22
8 0.21
9 0.2
10 0.24
11 0.21
12 0.21
13 0.29
14 0.34
15 0.39
16 0.47
17 0.56
18 0.62
19 0.69
20 0.77
21 0.78
22 0.77
23 0.81
24 0.82
25 0.81
26 0.79
27 0.78
28 0.77
29 0.76
30 0.77
31 0.75
32 0.72
33 0.72
34 0.72
35 0.75
36 0.76
37 0.79
38 0.82
39 0.86
40 0.89
41 0.9
42 0.92
43 0.92
44 0.94
45 0.94
46 0.94
47 0.95
48 0.96
49 0.96
50 0.95
51 0.95
52 0.94
53 0.94
54 0.94
55 0.93
56 0.92
57 0.92
58 0.9
59 0.9
60 0.91
61 0.91
62 0.91
63 0.91
64 0.89
65 0.88
66 0.9
67 0.89
68 0.89
69 0.87
70 0.82
71 0.76
72 0.73
73 0.67
74 0.63
75 0.62
76 0.58
77 0.52
78 0.56
79 0.54
80 0.56
81 0.62
82 0.63
83 0.65
84 0.69
85 0.71
86 0.67
87 0.67
88 0.66
89 0.62
90 0.54
91 0.49
92 0.42
93 0.39
94 0.37
95 0.34
96 0.29
97 0.23
98 0.22
99 0.18
100 0.16
101 0.16
102 0.15