Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZSD4

Protein Details
Accession A0A0C9ZSD4   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
18-38FPCVFRPTKHSKVHHRTQPRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR040976  Pkinase_fungal  
IPR000719  Prot_kinase_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF17667  Pkinase_fungal  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MNYRSRSRPGQVKDSPTFPCVFRPTKHSKVHHRTQPRLVFQEVRQLHSVDTVFATLEDARKALQFLHSVDGAHRDVGAGDVLRSGKIGKLADLEYAKRVDSNTTHEVRTGTLDFMACELEAQKYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.59
3 0.53
4 0.48
5 0.39
6 0.38
7 0.36
8 0.37
9 0.34
10 0.4
11 0.46
12 0.53
13 0.61
14 0.63
15 0.67
16 0.71
17 0.79
18 0.8
19 0.81
20 0.78
21 0.79
22 0.79
23 0.74
24 0.68
25 0.62
26 0.56
27 0.47
28 0.5
29 0.41
30 0.36
31 0.32
32 0.29
33 0.25
34 0.24
35 0.23
36 0.14
37 0.13
38 0.1
39 0.08
40 0.07
41 0.08
42 0.06
43 0.07
44 0.07
45 0.06
46 0.06
47 0.07
48 0.07
49 0.06
50 0.08
51 0.09
52 0.1
53 0.11
54 0.11
55 0.11
56 0.11
57 0.15
58 0.13
59 0.11
60 0.1
61 0.08
62 0.08
63 0.08
64 0.08
65 0.05
66 0.05
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.11
74 0.11
75 0.11
76 0.13
77 0.14
78 0.18
79 0.2
80 0.2
81 0.19
82 0.19
83 0.19
84 0.17
85 0.17
86 0.16
87 0.17
88 0.23
89 0.27
90 0.29
91 0.29
92 0.3
93 0.3
94 0.27
95 0.3
96 0.24
97 0.18
98 0.17
99 0.16
100 0.15
101 0.15
102 0.15
103 0.1
104 0.09
105 0.09