Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z8F7

Protein Details
Accession A0A0C9Z8F7   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-34WSSTVVQRRLRRLPVKKKKTTLVQSGHydrophilic
NLS Segment(s)
PositionSequence
19-26RRLPVKKK
Subcellular Location(s) mito 22.5, mito_nucl 13.166, cyto_nucl 3.333, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MEWRLGRVWSSTVVQRRLRRLPVKKKKTTLVQSGHGMTRVKASDSKEIMLVWVQAVPPPIQLTRVRTGPSIVSPRRILYTREHLYWQKDNSCWTRYWINTTIWFGRNSTSKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.56
4 0.6
5 0.67
6 0.7
7 0.73
8 0.77
9 0.8
10 0.85
11 0.86
12 0.85
13 0.83
14 0.83
15 0.8
16 0.78
17 0.72
18 0.66
19 0.61
20 0.57
21 0.5
22 0.44
23 0.36
24 0.27
25 0.25
26 0.21
27 0.18
28 0.19
29 0.21
30 0.25
31 0.26
32 0.26
33 0.23
34 0.22
35 0.21
36 0.17
37 0.14
38 0.07
39 0.07
40 0.06
41 0.06
42 0.08
43 0.07
44 0.07
45 0.08
46 0.08
47 0.11
48 0.13
49 0.16
50 0.18
51 0.2
52 0.21
53 0.2
54 0.21
55 0.19
56 0.22
57 0.26
58 0.25
59 0.27
60 0.27
61 0.28
62 0.3
63 0.31
64 0.29
65 0.26
66 0.35
67 0.34
68 0.35
69 0.39
70 0.4
71 0.44
72 0.48
73 0.46
74 0.41
75 0.39
76 0.44
77 0.44
78 0.43
79 0.38
80 0.36
81 0.39
82 0.36
83 0.42
84 0.4
85 0.39
86 0.41
87 0.45
88 0.47
89 0.42
90 0.41
91 0.35
92 0.35
93 0.37