Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9D527

Protein Details
Accession E9D527    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-73LSVEAHCKPANKKRKREESSHydrophilic
NLS Segment(s)
PositionSequence
65-69KKRKR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MSQEEDINVRVPGSVREPPTFDDQDAGAVLYNAARAAASKVPTEELSDGSVSGLSVEAHCKPANKKRKREESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.26
4 0.27
5 0.29
6 0.35
7 0.34
8 0.29
9 0.25
10 0.21
11 0.2
12 0.18
13 0.15
14 0.08
15 0.06
16 0.06
17 0.05
18 0.05
19 0.04
20 0.03
21 0.03
22 0.03
23 0.05
24 0.07
25 0.09
26 0.09
27 0.1
28 0.11
29 0.12
30 0.13
31 0.12
32 0.11
33 0.11
34 0.11
35 0.11
36 0.09
37 0.09
38 0.07
39 0.06
40 0.06
41 0.05
42 0.05
43 0.08
44 0.09
45 0.13
46 0.14
47 0.18
48 0.26
49 0.36
50 0.47
51 0.54
52 0.64
53 0.71