Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZT20

Protein Details
Accession A0A0C9ZT20   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-98LFHLHARRPWRRRGSARHRLWALHydrophilic
NLS Segment(s)
PositionSequence
83-90RPWRRRGS
Subcellular Location(s) nucl 19, cyto 5, plas 2
Family & Domain DBs
Amino Acid Sequences MATAIGSGLDLYRIPEHMRSHVCYRASCVHTHNLLPLSCTSTSPYPAQHTPSSSPLSPLARRSLPVRAAFLSFYLLFHLHARRPWRRRGSARHRLWALFLSYLSTKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.18
3 0.2
4 0.26
5 0.3
6 0.33
7 0.36
8 0.41
9 0.41
10 0.36
11 0.39
12 0.41
13 0.39
14 0.37
15 0.35
16 0.35
17 0.35
18 0.35
19 0.32
20 0.27
21 0.25
22 0.24
23 0.22
24 0.19
25 0.18
26 0.18
27 0.17
28 0.15
29 0.17
30 0.17
31 0.18
32 0.19
33 0.21
34 0.24
35 0.23
36 0.24
37 0.24
38 0.27
39 0.27
40 0.23
41 0.23
42 0.21
43 0.24
44 0.23
45 0.22
46 0.22
47 0.2
48 0.21
49 0.22
50 0.24
51 0.26
52 0.26
53 0.26
54 0.23
55 0.23
56 0.22
57 0.21
58 0.18
59 0.13
60 0.12
61 0.11
62 0.11
63 0.11
64 0.13
65 0.16
66 0.16
67 0.2
68 0.29
69 0.37
70 0.43
71 0.52
72 0.59
73 0.65
74 0.73
75 0.8
76 0.82
77 0.83
78 0.85
79 0.84
80 0.79
81 0.7
82 0.63
83 0.55
84 0.47
85 0.38
86 0.3
87 0.24
88 0.21