Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D9H5

Protein Details
Accession E9D9H5   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
101-131QRIPSGWTRRRHWRRRRRRHWWASGDRTRLRBasic
NLS Segment(s)
PositionSequence
108-121TRRRHWRRRRRRHW
Subcellular Location(s) nucl 12.5, cyto_nucl 8.5, pero 6, mito 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAPDCKCCPDYEDRAARECEDCQRGQGVHAGVCKRIHLLHHQRSFGEVSGRKAQDCQWRGHIVRDDLAWFRELLGGFEDLSIKVSRNPILKGGEPEPASEQRIPSGWTRRRHWRRRRRRHWWASGDRTRLRSSTRECQQHFEYESGPERARQRDIRISANGRRDAQWCRWRDLLALAKTIPGSRLRRQVAHEQKVSIWHLPIPRARQGMRICLALEAAREVKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.52
4 0.46
5 0.41
6 0.39
7 0.36
8 0.34
9 0.31
10 0.33
11 0.32
12 0.3
13 0.33
14 0.26
15 0.24
16 0.29
17 0.28
18 0.27
19 0.28
20 0.27
21 0.24
22 0.24
23 0.24
24 0.29
25 0.39
26 0.45
27 0.51
28 0.52
29 0.5
30 0.51
31 0.5
32 0.4
33 0.38
34 0.31
35 0.29
36 0.36
37 0.37
38 0.35
39 0.34
40 0.39
41 0.4
42 0.41
43 0.39
44 0.36
45 0.42
46 0.43
47 0.48
48 0.47
49 0.39
50 0.37
51 0.34
52 0.31
53 0.25
54 0.25
55 0.19
56 0.13
57 0.12
58 0.13
59 0.12
60 0.11
61 0.1
62 0.1
63 0.09
64 0.1
65 0.1
66 0.07
67 0.09
68 0.09
69 0.08
70 0.1
71 0.12
72 0.15
73 0.17
74 0.18
75 0.2
76 0.22
77 0.23
78 0.25
79 0.24
80 0.26
81 0.23
82 0.23
83 0.23
84 0.22
85 0.23
86 0.2
87 0.19
88 0.15
89 0.15
90 0.16
91 0.17
92 0.25
93 0.29
94 0.35
95 0.39
96 0.5
97 0.6
98 0.69
99 0.76
100 0.77
101 0.82
102 0.87
103 0.94
104 0.93
105 0.94
106 0.94
107 0.93
108 0.92
109 0.89
110 0.88
111 0.84
112 0.8
113 0.72
114 0.65
115 0.56
116 0.47
117 0.41
118 0.37
119 0.36
120 0.39
121 0.43
122 0.48
123 0.48
124 0.52
125 0.51
126 0.5
127 0.46
128 0.38
129 0.31
130 0.26
131 0.27
132 0.25
133 0.23
134 0.22
135 0.24
136 0.26
137 0.31
138 0.32
139 0.35
140 0.4
141 0.43
142 0.44
143 0.46
144 0.49
145 0.49
146 0.53
147 0.51
148 0.45
149 0.44
150 0.43
151 0.42
152 0.45
153 0.47
154 0.43
155 0.44
156 0.44
157 0.42
158 0.4
159 0.42
160 0.41
161 0.35
162 0.34
163 0.29
164 0.29
165 0.29
166 0.28
167 0.23
168 0.22
169 0.26
170 0.3
171 0.39
172 0.42
173 0.45
174 0.5
175 0.59
176 0.62
177 0.64
178 0.61
179 0.54
180 0.51
181 0.53
182 0.52
183 0.43
184 0.34
185 0.29
186 0.29
187 0.34
188 0.38
189 0.38
190 0.41
191 0.44
192 0.44
193 0.48
194 0.49
195 0.51
196 0.48
197 0.45
198 0.39
199 0.33
200 0.34
201 0.26
202 0.23
203 0.19