Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YGH2

Protein Details
Accession A0A0C9YGH2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDRRRQRFATRKPSKIKFQIPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDRRRQRFATRKPSKIKFQIPTSTVTKYIHQGSVDHPRKKKGSSYKNTNFGVQKGKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.76
5 0.73
6 0.71
7 0.62
8 0.6
9 0.53
10 0.46
11 0.39
12 0.34
13 0.28
14 0.24
15 0.24
16 0.21
17 0.18
18 0.18
19 0.19
20 0.29
21 0.36
22 0.4
23 0.41
24 0.45
25 0.48
26 0.5
27 0.55
28 0.55
29 0.57
30 0.61
31 0.69
32 0.72
33 0.78
34 0.77
35 0.75
36 0.67
37 0.6